Logo video2dn
  • Сохранить видео с ютуба
  • Категории
    • Музыка
    • Кино и Анимация
    • Автомобили
    • Животные
    • Спорт
    • Путешествия
    • Игры
    • Люди и Блоги
    • Юмор
    • Развлечения
    • Новости и Политика
    • Howto и Стиль
    • Diy своими руками
    • Образование
    • Наука и Технологии
    • Некоммерческие Организации
  • О сайте

Скачать или смотреть General Braddock

  • Gimme History
  • 2013-02-21
  • 3160
General Braddock
braddockgeneralbritish armyfrenchindianwarpennsylvaniafrontierhistorycyclingbicycleadventurefranklinamericanindependencephiladelphia
  • ok logo

Скачать General Braddock бесплатно в качестве 4к (2к / 1080p)

У нас вы можете скачать бесплатно General Braddock или посмотреть видео с ютуба в максимальном доступном качестве.

Для скачивания выберите вариант из формы ниже:

  • Информация по загрузке:

Cкачать музыку General Braddock бесплатно в формате MP3:

Если иконки загрузки не отобразились, ПОЖАЛУЙСТА, НАЖМИТЕ ЗДЕСЬ или обновите страницу
Если у вас возникли трудности с загрузкой, пожалуйста, свяжитесь с нами по контактам, указанным в нижней части страницы.
Спасибо за использование сервиса video2dn.com

Описание к видео General Braddock

This video clip is about General Braddock and his role in history. It is part of a series produced by Bicycling Through History. http://www.BicyclingThroughHistory.com

The series was originally produced on DVD and it is now gradually migrating to online distribution via YouTube. The DVDs were very popular with libraries. Many librarians decided to procure either individual DVDs or the whole series for their collections because they serve several purposes. They provide a multi-media presentation of categories in History, Travel, Geography, Music, Sports, Fitness and Adventure. The series was developed to encourage additional reading or research in all these topics.

Online versions fall into two separate groups. There were Quicktime videos uploaded before YouTube became popular. Those primarily feature nautical themes and winter sports. The clips uploaded more recently to YouTube are modified versions of some DVD segments and some newer clips in High Definition (HD).

ALL the music is licensed. It is either "Buy-Out" music licensed through Flying Hands, Media Beat or ConTempo, or it is in Public Domain and is licensed through the performers on camera. Most productions take place in Public Areas, such as trails, thorofares or parks where permission to take video has either been sought or is not required.

Bicycling Through History presents programs showing popular cycling trails that provide a unique perspective. Many people ride recreational trails and probably do not know the history associated with them. The purpose of the series is to acquaint viewers with the landmarks that can be see while cycling, hiking, inline skating or horseback riding. In many cases, these trails follow the same routes taken by important people in history or else the routes demonstrate some other significant event(s).

The series combines Reenactors with Period Music and other Accoutrements to impart facets of history that might otherwise be totally missed in reading books or conducting research in specific areas. The pace of cycling is similar to the modes of travel back in earlier times. Driving in an automobile will simply not provide the same experience as cycling, hiking or horseback riding. Once viewers know what to look for, they can enjoy their travels along these same routes even more.

Online clips will have links in chronological order from top to bottom. More clips will be added as they become available. Please return to the site for additional information and updates - http://www.BicyclingThroughHistory.com

Комментарии

Информация по комментариям в разработке

Похожие видео

  • О нас
  • Контакты
  • Отказ от ответственности - Disclaimer
  • Условия использования сайта - TOS
  • Политика конфиденциальности

video2dn Copyright © 2023 - 2025

Контакты для правообладателей [email protected]