Logo video2dn
  • Сохранить видео с ютуба
  • Категории
    • Музыка
    • Кино и Анимация
    • Автомобили
    • Животные
    • Спорт
    • Путешествия
    • Игры
    • Люди и Блоги
    • Юмор
    • Развлечения
    • Новости и Политика
    • Howto и Стиль
    • Diy своими руками
    • Образование
    • Наука и Технологии
    • Некоммерческие Организации
  • О сайте

Скачать или смотреть Cooking Universal: Chef’s Game 🐌 Chicago Toast - Part 5 💦 Gameplay Walkthrough 🍉

  • HAPPY Planet
  • 2025-11-04
  • 5
Cooking Universal: Chef’s Game 🐌 Chicago Toast - Part 5 💦 Gameplay Walkthrough 🍉
cookinguniversalcookinguniversalchefchefgamescookinggamecookingvideogamesgaminggameplaygameplaywalkthroughfunnyiosgamesandroidgamesgamergameshortsgamerlifegamergirlcasualcasualgamingcasualgamespuzzlepuzzlegamefooddishesworldrestaurantservedinersmealsvarietydelectableearthnumeroushappyplanet
  • ok logo

Скачать Cooking Universal: Chef’s Game 🐌 Chicago Toast - Part 5 💦 Gameplay Walkthrough 🍉 бесплатно в качестве 4к (2к / 1080p)

У нас вы можете скачать бесплатно Cooking Universal: Chef’s Game 🐌 Chicago Toast - Part 5 💦 Gameplay Walkthrough 🍉 или посмотреть видео с ютуба в максимальном доступном качестве.

Для скачивания выберите вариант из формы ниже:

  • Информация по загрузке:

Cкачать музыку Cooking Universal: Chef’s Game 🐌 Chicago Toast - Part 5 💦 Gameplay Walkthrough 🍉 бесплатно в формате MP3:

Если иконки загрузки не отобразились, ПОЖАЛУЙСТА, НАЖМИТЕ ЗДЕСЬ или обновите страницу
Если у вас возникли трудности с загрузкой, пожалуйста, свяжитесь с нами по контактам, указанным в нижней части страницы.
Спасибо за использование сервиса video2dn.com

Описание к видео Cooking Universal: Chef’s Game 🐌 Chicago Toast - Part 5 💦 Gameplay Walkthrough 🍉

Cooking Universal: Chef’s Game 🐌 Chicago Toast - Part 5 💦 Gameplay Walkthrough 🍉

🥪 Let’s cook food worldwide in tasty restaurants - Dash in Fantasy cuisine kitchen.

Are you the kind of person who has an endless passion for food fever?
You are a true gourmet? 🍱 🥪 🌭 🍕 🥐

Have you ever thought about the prospect that our Earth will be filled with countless extremely attractive dishes? Each of your flights will land in a colorful food kingdom with unforgettable flavors.

There will be numerous unexpected joys along your culinary discovery journey that you never seen that before. You show off your chef skills, cook delicious dishes to serve diners.

You will impress even the most demanding diners with regional specialties from all over the world such as Japanese, French, Singaporean, American meals, fast food, cakes, coffee, tea, …

🧁From sweet desserts to mouth-watering burgers, from Singapore lobster to the famous French Escargot grilled snails, combining them with seasonal signature elements creates a frenzy cuisine world full of surprises.

🍕Diners at the American restaurant will be eager to try the New York Pizza, classic Apple Pie, or the high-protein, fresh Alaskan king crab.
Otherwise, tourists can satisfy their hunger with a variety of delectable fast-food options such as hamburgers, pizza, french fries, sandwiches, hotdogs, and so on.

🥩The European restaurant serves exquisite French standard steaks, French bread, croissants, and quality Bordeaux wines in addition to the traditional grilled snail cuisine.

🍣Asian visitors beside that may enjoy your authentic Japanese sashimi, ramen, and bento... There will be plenty of delicious food waiting for you, as well as opportunities to practice your cooking skills in a variety of different kitchens and learn unique food preparation techniques from around the world!

#cookinguniversal #cooking #universal #chef #chefgames #cookinggame #cookingvideo #games #gaming #gameplay #gameplaywalkthrough #funny #iosgames #androidgames #gamer #gameshorts #gamerlife #gamergirl #casual #casualgaming #casualgames #puzzle #puzzlegame #food #dishes #world #restaurant #serve #diners #meals #variety #delectable #earth #numerous #happyplanet

Комментарии

Информация по комментариям в разработке

Похожие видео

  • О нас
  • Контакты
  • Отказ от ответственности - Disclaimer
  • Условия использования сайта - TOS
  • Политика конфиденциальности

video2dn Copyright © 2023 - 2025

Контакты для правообладателей [email protected]