Logo video2dn
  • Сохранить видео с ютуба
  • Категории
    • Музыка
    • Кино и Анимация
    • Автомобили
    • Животные
    • Спорт
    • Путешествия
    • Игры
    • Люди и Блоги
    • Юмор
    • Развлечения
    • Новости и Политика
    • Howto и Стиль
    • Diy своими руками
    • Образование
    • Наука и Технологии
    • Некоммерческие Организации
  • О сайте

Скачать или смотреть Martin Bernini - Disorder (Original Mix) [UV068 - Univack Records]

  • Univack
  • 2020-10-04
  • 291
Martin Bernini - Disorder (Original Mix)  [UV068 - Univack Records]
technomelodic technodeep houseprogressive houseprogressivehouseelectronicaneo trancemelodic2016melodic housemelodic house & technodeepdeeptechnodeep-techdeep-houseelectroelectronictech-housetech houseclubfestivallivesetmixafterlifedyinamicbedrockibizaunivackintegral breadelio ksminimalhappydarkspainsevilla201520142013201720182019
  • ok logo

Скачать Martin Bernini - Disorder (Original Mix) [UV068 - Univack Records] бесплатно в качестве 4к (2к / 1080p)

У нас вы можете скачать бесплатно Martin Bernini - Disorder (Original Mix) [UV068 - Univack Records] или посмотреть видео с ютуба в максимальном доступном качестве.

Для скачивания выберите вариант из формы ниже:

  • Информация по загрузке:

Cкачать музыку Martin Bernini - Disorder (Original Mix) [UV068 - Univack Records] бесплатно в формате MP3:

Если иконки загрузки не отобразились, ПОЖАЛУЙСТА, НАЖМИТЕ ЗДЕСЬ или обновите страницу
Если у вас возникли трудности с загрузкой, пожалуйста, свяжитесь с нами по контактам, указанным в нижней части страницы.
Спасибо за использование сервиса video2dn.com

Описание к видео Martin Bernini - Disorder (Original Mix) [UV068 - Univack Records]

Buy Link: https://www.beatport.com/release/insi...

Genre: Progressive House / Melodic Techno

"Inside The Univack" is the title of the periodical Various Artist EP compilation that Univack release each one or two years.

With this vol.5 Univack wants to bring a resume of the musical spirit that drive the label. Wide range of Melodic and Progressive club music, from deep and electronica to house and techno. Sometimes warm and sweet, sometimes dark and sharp, always elegant, daring to cross the thin line that separates these genres.

QuiQui (Traum, Manual Music, Aftertech) aka Jeroen Wiggers opens the EP with "Bloody Moon", a Leftfield Melodic Techno track close to the pure Electronica, with complex melodic and percussive elements and a complete analogical taste. Is a great pleasure to have the french producer in our label, who already release an artist EP in our beginnings.

Another known of our label, the spanish duo WO-CORE (Steyoyoke, Beatfreak, Dear Dee) presents their "Last To Piano", a strong and powered Melodic Techno track with a solid groove and memorable melodic sequence, perfect for the hottest moments of the night.

The argentinian Martin Bernini continues the EP with his "Disorder", a Progressive House track with plenty of organic sounds, pads and vocals, directed through a beautiful and hipnotic journey wich is helped with its nice groove.

The also argentinian Teleport-X (Droid9, Welcome!) presents us his "Yamila". A deep, organic and progressive house piece which will wake up our most emotional feelings in the dance floor. Perfect for a sunset or a dawn.

The Frech producer Atribút (Armada, SONY, FSOE) joins forces with canadian singer Denis Commie to make this beautiful "Back On Top". A track between Progressive House and Melodic House, with the sweet taste of classic hyms.

Evegrem (Freegrant Music, Soundteller) close the EP with this "Serenity", which bring us an emotional calm with its several harmonic elements. Another track between Progressive House and Melodic Techno that shows the great potential of this young argentinian producer.


Website - http://www.univack.com
Souncloud -   / univackrecords  
Facebook -   / univackrecords  
Instagram -   / univackrecords  
Youtube -    / univack  
Beatport - http://www.beatport.com/label/univack...
Bandcamp - http://univack.bandcamp.com

Комментарии

Информация по комментариям в разработке

Похожие видео

  • О нас
  • Контакты
  • Отказ от ответственности - Disclaimer
  • Условия использования сайта - TOS
  • Политика конфиденциальности

video2dn Copyright © 2023 - 2025

Контакты для правообладателей [email protected]