Logo video2dn
  • Сохранить видео с ютуба
  • Категории
    • Музыка
    • Кино и Анимация
    • Автомобили
    • Животные
    • Спорт
    • Путешествия
    • Игры
    • Люди и Блоги
    • Юмор
    • Развлечения
    • Новости и Политика
    • Howto и Стиль
    • Diy своими руками
    • Образование
    • Наука и Технологии
    • Некоммерческие Организации
  • О сайте

Скачать или смотреть Batatyachi Kaapa | Potato Rava Fry | Maharashtrian Recipe

  • Food and Frolic
  • 2021-05-07
  • 6241
Batatyachi Kaapa | Potato Rava Fry | Maharashtrian Recipe
foodandfrolicaloofryeasyrecipesquickrecipessimplerecipespotato frypotatofriesfriedpotatopotatorecipessidedishquickpotatorecipesmaharashtrianrecipesmarathirecipesmaharashtriandishmaharashtrianfoodeasymarathirecipesfryrecipesfriedrecipefingerfoodfriedpotatochipsalooeasyaloorecipessimplerecipesimplefrysimplefriedravafryravafriedpotatoravafrypotatofrypotatopotatorecipeeasypotatorecipealoofriesaloofriedfriedpotatoesfriedaloorecipequickrecipeeasyrecipe
  • ok logo

Скачать Batatyachi Kaapa | Potato Rava Fry | Maharashtrian Recipe бесплатно в качестве 4к (2к / 1080p)

У нас вы можете скачать бесплатно Batatyachi Kaapa | Potato Rava Fry | Maharashtrian Recipe или посмотреть видео с ютуба в максимальном доступном качестве.

Для скачивания выберите вариант из формы ниже:

  • Информация по загрузке:

Cкачать музыку Batatyachi Kaapa | Potato Rava Fry | Maharashtrian Recipe бесплатно в формате MP3:

Если иконки загрузки не отобразились, ПОЖАЛУЙСТА, НАЖМИТЕ ЗДЕСЬ или обновите страницу
Если у вас возникли трудности с загрузкой, пожалуйста, свяжитесь с нами по контактам, указанным в нижней части страницы.
Спасибо за использование сервиса video2dn.com

Описание к видео Batatyachi Kaapa | Potato Rava Fry | Maharashtrian Recipe

#FoodAndFrolic #AlooRavaFry #FoodRecipe

This is a very easy, super delicious Maharashtrian recipe called Batatychi Kaapa which is also another word for potato rava fry. As simple as this is, it takes only 5 mins to make and news very few ingredients.

Ingredients:
1 large potato
1 tsp of turmeric powder
1 tsp of chilly powder
Salt
Alternatively, can be made with an eggplant instead of a potato.

Just slice up the potatoes about a quarter inch thick. Dry rub it with chilly powder, turmeric and salt. DO NOT ADD WATER at all. Then coat it well with thin rava/semolina. Shallow fry well. Watch the video for more details.

Served hot with dal rice, batatychi kaapa/potato rava fry is a perfect accompaniment to any of your meals. It is simple, easy and very delicious.

Do try it out and let me know how you enjoyed the recipe!
Don't forget to like the video and subscribe to my channel for more such quick and easy recipes.

Комментарии

Информация по комментариям в разработке

Похожие видео

  • Soya tikka masala recipe | high protein soya bean ki sabzi #soya #soyamasala #highprotein
    Soya tikka masala recipe | high protein soya bean ki sabzi #soya #soyamasala #highprotein
    11 месяцев назад
  • О нас
  • Контакты
  • Отказ от ответственности - Disclaimer
  • Условия использования сайта - TOS
  • Политика конфиденциальности

video2dn Copyright © 2023 - 2025

Контакты для правообладателей [email protected]