Logo video2dn
  • Сохранить видео с ютуба
  • Категории
    • Музыка
    • Кино и Анимация
    • Автомобили
    • Животные
    • Спорт
    • Путешествия
    • Игры
    • Люди и Блоги
    • Юмор
    • Развлечения
    • Новости и Политика
    • Howto и Стиль
    • Diy своими руками
    • Образование
    • Наука и Технологии
    • Некоммерческие Организации
  • О сайте

Скачать или смотреть Why Congress Is Seriously Investigating UFOs

  • Astrum
  • 2025-07-24
  • 818211
Why Congress Is Seriously Investigating UFOs
Astrumspaceastrum spaceastrumspaceastronomyastrophysicssciencephysicsdocumentaryspace documentaryscience documentaryearthplanetplanetssolar systemNASAESAUFOUFOsUAPunidentified flying objectUnidentified Aerial Phenomenacongresspentagongovernmentusaalienaliensalien invasionsightingevidencespacecraftspaceshipmilitaryairforceImmaculate ConstellationvideorealimagesCIAflying saucercontactmissioncover upsecrettop secretgrusch
  • ok logo

Скачать Why Congress Is Seriously Investigating UFOs бесплатно в качестве 4к (2к / 1080p)

У нас вы можете скачать бесплатно Why Congress Is Seriously Investigating UFOs или посмотреть видео с ютуба в максимальном доступном качестве.

Для скачивания выберите вариант из формы ниже:

  • Информация по загрузке:

Cкачать музыку Why Congress Is Seriously Investigating UFOs бесплатно в формате MP3:

Если иконки загрузки не отобразились, ПОЖАЛУЙСТА, НАЖМИТЕ ЗДЕСЬ или обновите страницу
Если у вас возникли трудности с загрузкой, пожалуйста, свяжитесь с нами по контактам, указанным в нижней части страницы.
Спасибо за использование сервиса video2dn.com

Описание к видео Why Congress Is Seriously Investigating UFOs

In honor of UFO Day this month, we’re examining all of the evidence to uncover the truth about UFOs.
Get NordVPN 2Y plan + 4 months extra ➼ https://nordvpn.com/astrum. It’s risk-free with Nord’s 30-day money-back guarantee!

▀▀▀▀▀▀

Recent observations of exoplanet K2-18b have revealed compelling evidence for potential life beyond Earth. This discovery raises profound questions: Are there intelligent beings elsewhere in the cosmos? Could they have already visited our planet? In this video, we’re digging into the evidence, examining UFO (or UAP) sightings and investigating whether the Pentagon is concealing evidence from the public.

Our first Astrum video on UFOs can be found here:    • Multiple US NAVY Sensors Detected Somethin...  

▀▀▀▀▀▀

Astrum's newsletter has launched! Sign up to stay in the know: https://astrumspace.kit.com

▀▀▀▀▀▀

Astrum Displate Posters: https://astrumspace.info/Displates
Astrum Infographic Artwork: https://electrify.art/collections/astrum
Astrum Merch: https://astrum-shop.fourthwall.com/

Join us on the Astrum discord:   / discord  

A huge thanks to our Patreons who help make these videos possible. Sign-up here to support the channel: https://bit.ly/4aiJZNF

▀▀▀▀▀▀

Astrum Podcast on Spotify: https://open.spotify.com/show/6jPRrbq...

Astrum Earth:    / @astrumearth  
Astrum Extra:    / @astrumextra  

Astrum Spanish:    / @astrumespanol  
Astrum Portuguese:    / @astrumbrasil  

▀▀▀▀▀▀

References:
"New Constraints on DMS and DMDS in the Atmosphere of K2-18 b from JWST MIRI", via arxiv.org https://astrumspace.info/lifeonexoplanet
"Scientists find 'strongest evidence yet' of life on distant planet", via bbc.co.uk https://astrumspace.info/signsoflife
"Preliminary Assessment: Unidentified Aerial Phenomena", via dni.gov https://astrumspace.info/UAPassessment
"UAP Transcript", via congress.gov https://astrumspace.info/UAPtranscript
"All-domain Anomaly Resolution Office (AARO)", via aaro.mil https://astrumspace.info/AARO
"2022 Annual Report on Unidentified Aerial Phenomena", via dni.gov https://astrumspace.info/UAP2022
"Hearing to Receive Testimony on the Mission, Activities, Oversight, and Budget of the All-Domain Anomaly Resolution Office", via senate.gov https://astrumspace.info/AAROhearing
"Unidentified Anomalous Phenomena: Implications on National Security, Public Safety, and Government Transparency", via congress.gov https://astrumspace.info/Gruschhearing
"The UFO Chase You Saw in ‘Close Encounters’", via medium.com https://astrumspace.info/UFOchase
"Chinese spy balloon did not collect information, says Pentagon", via bbc.co.uk https://astrumspace.info/spyballoon
"Mysterious New Jersey drones were 'not the enemy' - White House", via bbc.co.uk https://astrumspace.info/NewJerseydrones
"Immaculate Constellation", via congress.gov https://astrumspace.info/immaculateco...
"UFO whistleblower Jake Barber would '100% testify' under oath to Congress", via youtube.com https://astrumspace.info/JakeBarber
"The remote viewers", via theguardian.com https://astrumspace.info/psionics

▀▀▀▀▀▀

Credits:
Writer: Jon McColgan
Video Editors: Nick Shishkin, Nathália Huzian, James Horsley
Researcher: Edie Abrahams
Script Editor: Damaris McColgan
Thumbnail Designer: Peter Sheppard
Channel Manager: Georgina Brenner
Executive Producer: Raquel Taylor
Creator of Astrum: Alex McColgan

With special thanks to:
NASA/ESO/ESA

#astrum #space #ufo #uap

Комментарии

Информация по комментариям в разработке

Похожие видео

  • О нас
  • Контакты
  • Отказ от ответственности - Disclaimer
  • Условия использования сайта - TOS
  • Политика конфиденциальности

video2dn Copyright © 2023 - 2025

Контакты для правообладателей [email protected]