Logo video2dn
  • Сохранить видео с ютуба
  • Категории
    • Музыка
    • Кино и Анимация
    • Автомобили
    • Животные
    • Спорт
    • Путешествия
    • Игры
    • Люди и Блоги
    • Юмор
    • Развлечения
    • Новости и Политика
    • Howto и Стиль
    • Diy своими руками
    • Образование
    • Наука и Технологии
    • Некоммерческие Организации
  • О сайте

Скачать или смотреть Top 5 Weirdest Ant Species! | AntHub PH

  • AntHub PH
  • 2019-03-25
  • 104188
Top 5 Weirdest Ant Species! | AntHub PH
antsantant colonycolonyant farmnatureinsectmyrmecologyfactstriviaslanggamphilippinesant philippinesants in the philippinesdinomyrmex gigashoneypot antsmyrmeciamyrmecocytusexploding antsturtle antsgiant antsjumping antsant factsanthub phanthubweird animalsanimalscoloniesants for salequeen antsant queenhow to keep antsants as petsfilipino antspinoy antsmierenexotic pets
  • ok logo

Скачать Top 5 Weirdest Ant Species! | AntHub PH бесплатно в качестве 4к (2к / 1080p)

У нас вы можете скачать бесплатно Top 5 Weirdest Ant Species! | AntHub PH или посмотреть видео с ютуба в максимальном доступном качестве.

Для скачивания выберите вариант из формы ниже:

  • Информация по загрузке:

Cкачать музыку Top 5 Weirdest Ant Species! | AntHub PH бесплатно в формате MP3:

Если иконки загрузки не отобразились, ПОЖАЛУЙСТА, НАЖМИТЕ ЗДЕСЬ или обновите страницу
Если у вас возникли трудности с загрузкой, пожалуйста, свяжитесь с нами по контактам, указанным в нижней части страницы.
Спасибо за использование сервиса video2dn.com

Описание к видео Top 5 Weirdest Ant Species! | AntHub PH

Please SUBSCRIBE to #AntHubPH if you enjoyed!

🔴SUBSCRIBE to AntHub PH:
https://bit.ly/2Wfo2bM

🔴 Watch me unbox new colonies!
   • Unboxing 2 New Ant Colonies! | AntHub PH  

🔴The weirdest ant Species
   • Top 5 Weirdest Ant Species! | AntHub PH  
🔴 Wanna know how to catch a queen? Watch this!
   • How to Catch Queen Ants? (TAGALOG!)  

🔴Like us on Facebook!
Facebook Page:   / anthubph  

🔴Follow us on Instagram!
Instagram:   / anthub_ph  

🔴Join our Filipino Facebook group:
  / 12830.  .

🔴For questions, suggestions, and inquiries, email us at:
[email protected]

Disclaimer:
The background music(s) used for this video is not mine. Credits go to the rightful owner. No Copyright Infringement is Intended.

About us:
AntHub PH is the home for ant keepers and ant enthusiasts. This YouTube Channel is dedicated to ant tutorials and keeping tips, ant colony updates, and other things concerning ants and their nature. The AntHub PH channel was founded 25th of February, 2019. The creator is based in Tarlac City, Philippines.

This channel was created to spread information and educate people about ants and their nature. We, the AntHub PHILIPPINES Crew, advocate environmental literacy, habitat conservation, and ecological responsibility by means of ant videos. We from AntHub PH envision a world full of ant enthusiasts🐜 Keywords
ant war,
ant bully,
ant and dec,
ant colony,
ant and dec prank,
ant movie,
ant farm,
ant and seb,
ant attack,
ant and the grasshopper story,
ant aquarium,
ant and dec song,
ant assassin,
ant and the grasshopper song,
a ants life,
a ant song,
a ants life movie,
aa ants in my arms,
a ant giving birth,
a ant bully,
a antelope,
a anteater,
a ant bite,
a antigen,
ant bloxburg,
ant budots,
ant bite,
ant bully full movie,
ant bully song,
ant battle,
ant bully movie,
ant bully trailer,
ant cartoon,
ant colony war,
ant colony game,
antscanada,
catriona gray,
ant detective,
ant documentary,
ant dec prank,
ant design,
ant dance,
ant diss track,
ant drawing,
ant dec,
ant design react,
ant drinking honey,
d ante d full movie,
anteater,
ant eating,
ants eat human,
ant egg,
ant experiment,
ant evolution,
ant empire,
ant enclosure,
ant eating snake,
ant evolution game

Комментарии

Информация по комментариям в разработке

Похожие видео

  • О нас
  • Контакты
  • Отказ от ответственности - Disclaimer
  • Условия использования сайта - TOS
  • Политика конфиденциальности

video2dn Copyright © 2023 - 2025

Контакты для правообладателей [email protected]