Logo video2dn
  • Сохранить видео с ютуба
  • Категории
    • Музыка
    • Кино и Анимация
    • Автомобили
    • Животные
    • Спорт
    • Путешествия
    • Игры
    • Люди и Блоги
    • Юмор
    • Развлечения
    • Новости и Политика
    • Howto и Стиль
    • Diy своими руками
    • Образование
    • Наука и Технологии
    • Некоммерческие Организации
  • О сайте

Скачать или смотреть Fresh fish cleaning and selling by fish vendor in Badlapur - Basa, Knife Fish, Catla, Rohu

  • WildFilmsIndia
  • 2020-08-22
  • 1311
Fresh fish cleaning and selling by fish vendor in Badlapur - Basa, Knife Fish, Catla, Rohu
indiaasiastockfootageincredibletourismwildernessfilmswildfilmsindiahdimageryphotographlicensewww.wildfilmsindia.comwww.youtube.com/wildfilmsindiathe best of indiahigh definitionBasaKnife FishCatlaRohufish vendorfishingorange-bellied piranhacommon fishes
  • ok logo

Скачать Fresh fish cleaning and selling by fish vendor in Badlapur - Basa, Knife Fish, Catla, Rohu бесплатно в качестве 4к (2к / 1080p)

У нас вы можете скачать бесплатно Fresh fish cleaning and selling by fish vendor in Badlapur - Basa, Knife Fish, Catla, Rohu или посмотреть видео с ютуба в максимальном доступном качестве.

Для скачивания выберите вариант из формы ниже:

  • Информация по загрузке:

Cкачать музыку Fresh fish cleaning and selling by fish vendor in Badlapur - Basa, Knife Fish, Catla, Rohu бесплатно в формате MP3:

Если иконки загрузки не отобразились, ПОЖАЛУЙСТА, НАЖМИТЕ ЗДЕСЬ или обновите страницу
Если у вас возникли трудности с загрузкой, пожалуйста, свяжитесь с нами по контактам, указанным в нижней части страницы.
Спасибо за использование сервиса video2dn.com

Описание к видео Fresh fish cleaning and selling by fish vendor in Badlapur - Basa, Knife Fish, Catla, Rohu

Fish vendors on the way to Kondeshwar Falls, in Maharashtra sells commonly consumed fishes. Watch the fish vendor cleaning the scales off a fish with dexterity and speed. Commonly consumed fishes like Orange-bellied Piranha, Catla, Rohu, Knife Fish, Basa are on display.

Fish is a common protein diet in the coastal regions of India. FIsh is also a chief source of livelihood for fishermen and communities living in the coastal plains of India.

This footage is part of the broadcast stock footage archive of Wilderness Films India Ltd., the largest HD and 4K collection from South Asia. The collection comprises of 150, 000+ hours of high quality broadcast imagery, mostly shot on 4K, 200 fps slow motion and Full HD. Write to us for licensing this footage on a broadcast format, for use in your production! We are happy to be commissioned to film for you or else provide you with broadcast crewing and production solutions across South Asia. We pride ourselves in bringing the best of India and South Asia to the world...

Please subscribe to our channel wildfilmsindia on Youtube    / @wildfilmsindia   and The Best of India at    / @thebestofindia2849   for a steady stream of videos from across India. Also, visit and enjoy your journey across India at www.clipahoy.com , India's first video-based social networking experience.

Reach us at rupindang [at] gmail [dot] com and [email protected]

To SUBSCRIBE click the below link:
   / @wildfilmsindia  
and
   / @thebestofindia2849  

Like & Follow Us on:
Facebook:   / wildernessfilmsindialimited  
Website: https://wildfilmsindia.com/

#WildFilmsIndia #WildernessFilmsIndia #BroadcastStockFootage

Комментарии

Информация по комментариям в разработке

Похожие видео

  • О нас
  • Контакты
  • Отказ от ответственности - Disclaimer
  • Условия использования сайта - TOS
  • Политика конфиденциальности

video2dn Copyright © 2023 - 2025

Контакты для правообладателей [email protected]