Logo video2dn
  • Сохранить видео с ютуба
  • Категории
    • Музыка
    • Кино и Анимация
    • Автомобили
    • Животные
    • Спорт
    • Путешествия
    • Игры
    • Люди и Блоги
    • Юмор
    • Развлечения
    • Новости и Политика
    • Howto и Стиль
    • Diy своими руками
    • Образование
    • Наука и Технологии
    • Некоммерческие Организации
  • О сайте

Скачать или смотреть Using the TOP 5 BEST PVP Fruits in Bounty Hunting - Blox Fruits

  • Blox Gaming
  • 2025-12-14
  • 26068
Using the TOP 5 BEST PVP Fruits in Bounty Hunting - Blox Fruits
robloxblox fruits robloxroblox blox fruitsblox fruitstop 5 best fruitstop 5 besttop 5painkitsunedoughlightningdragoneast dragonwest dragondragon talonsanguine artsharkman karategodhumancdkcursed dual katanaspikey tridentfox lampdragonstormskull guitarsoul guitarghoul v4combinationbuildpvpbounty huntingbounty huntcombobest one shot comboeasyfastefficientsimplecrackedcrazyopoverpoweredbraindeadbrokeninsanemetafun
  • ok logo

Скачать Using the TOP 5 BEST PVP Fruits in Bounty Hunting - Blox Fruits бесплатно в качестве 4к (2к / 1080p)

У нас вы можете скачать бесплатно Using the TOP 5 BEST PVP Fruits in Bounty Hunting - Blox Fruits или посмотреть видео с ютуба в максимальном доступном качестве.

Для скачивания выберите вариант из формы ниже:

  • Информация по загрузке:

Cкачать музыку Using the TOP 5 BEST PVP Fruits in Bounty Hunting - Blox Fruits бесплатно в формате MP3:

Если иконки загрузки не отобразились, ПОЖАЛУЙСТА, НАЖМИТЕ ЗДЕСЬ или обновите страницу
Если у вас возникли трудности с загрузкой, пожалуйста, свяжитесь с нами по контактам, указанным в нижней части страницы.
Спасибо за использование сервиса video2dn.com

Описание к видео Using the TOP 5 BEST PVP Fruits in Bounty Hunting - Blox Fruits

In this video, I will be using the following fruits, each with a specific META BUILD, to then rank them by how GOOD they were at the end of the video: Dough, Pain, Kitsune, Lightning, Dragon East / West Dragon. This is a bounty hunting sequence, demonstrating how OP the fruits and builds BEST one shot combos are inside of Blox Fruits PVP.

Video link:    • Using the TOP 5 BEST PVP Fruits in Bounty ...  

Roblox Profile: Spotted_Cougar - https://www.roblox.com/users/87010504...

Discord User: blox_gaming_yt

Roblox Group: Blox's Fans Group - https://www.roblox.com/communities/83...

Discord Server: Blox Hangouts -   / discord  


Tags:

#roblox #bloxfruits #dragon #eastdragon #westdragon #kitsune #lightning #pain #dough #combination #build #pvp #bountyhunting #bountyhunt #combo #bestoneshotcombo #insane #meta #technique #way #strategy #method #lifehack #script #entertaining #interesting

Комментарии

Информация по комментариям в разработке

Похожие видео

  • О нас
  • Контакты
  • Отказ от ответственности - Disclaimer
  • Условия использования сайта - TOS
  • Политика конфиденциальности

video2dn Copyright © 2023 - 2025

Контакты для правообладателей [email protected]