Logo video2dn
  • Сохранить видео с ютуба
  • Категории
    • Музыка
    • Кино и Анимация
    • Автомобили
    • Животные
    • Спорт
    • Путешествия
    • Игры
    • Люди и Блоги
    • Юмор
    • Развлечения
    • Новости и Политика
    • Howto и Стиль
    • Diy своими руками
    • Образование
    • Наука и Технологии
    • Некоммерческие Организации
  • О сайте

Скачать или смотреть Cameo - Favorite & Hyperlink Model Elements

  • CameoMagic
  • 2023-04-05
  • 1203
Cameo - Favorite & Hyperlink Model Elements
bookmarkcameofavoritehyperlinkmagicdrawnavigation pageCameo Enterprise ArchitectureCameo Enterprise Architecture TutorialCameo Enterprise Architecture 2021xCameo Enterprise ArchitectCameo Enterprise Architecture trainingCameo Systems ModelerCameo Systems Modeler tutorialCameo Systems Modeler simulationCameo Systems Modeler exampleCameoMagicMagicdrawMagicdraw TutorialMagicdraw SysML tutorial
  • ok logo

Скачать Cameo - Favorite & Hyperlink Model Elements бесплатно в качестве 4к (2к / 1080p)

У нас вы можете скачать бесплатно Cameo - Favorite & Hyperlink Model Elements или посмотреть видео с ютуба в максимальном доступном качестве.

Для скачивания выберите вариант из формы ниже:

  • Информация по загрузке:

Cкачать музыку Cameo - Favorite & Hyperlink Model Elements бесплатно в формате MP3:

Если иконки загрузки не отобразились, ПОЖАЛУЙСТА, НАЖМИТЕ ЗДЕСЬ или обновите страницу
Если у вас возникли трудности с загрузкой, пожалуйста, свяжитесь с нами по контактам, указанным в нижней части страницы.
Спасибо за использование сервиса video2dn.com

Описание к видео Cameo - Favorite & Hyperlink Model Elements

Presenting within Cameo can be a difficult task. It can be helpul to have frequently used elements and diagrams favorited or hyperlined for easy access.

This example shows how to add, remove, and edit favorites and hyperlinks within Cameo.

This video was created within Cameo Enterprise Architecture 2021x. The other versions including Cameo Systems Modeler, MagicDraw, 19.0, and 2022x will behave in a similar fashion. This example will provide information regarding Digital Engineering (DE), Model Based Systems Engineering (MBSE), and SysML.

Video compatible with the following versions of SysML Tools
-Cameo Systems Modeler 19.0
-Cameo Systems Modeler 2021x
-Cameo Systems Modeler 2022x
-Cameo Enterprise Architecture 19.0
-Cameo Enterprise Architecture 2021x (used in this demo)
-Cameo Enterprise Architecture 2022x
-MagicDraw 19.0
-MagicDraw 2021x
-MagicDraw 2022x

Video relevant or similar to the following Tools
-IBM Rational Rhapsody
-Oracle Sparx Systems Enterprise Architect
-Genesys by Vitech
-Microsoft Vizio


#SysML #DigitalEngineering #MBSE #engineering #CameoSystemsModeler #MagicDraw #simulation #ModelBasedSystemsEngineering #UML #SystemsEngineering #SystemDesign #SystemArchitecture #design #methodology #digitaltransformation


SysML Diagrams:

SysML Structural Diagrams:

Block Definition Diagram: #bdd #blockdefinitiondiagram
-Block, Interface Block, Constraint Block, Value Type, Enumeration, Signal, Instance, Proxy Port, Full Port, Directed Aggregation, Directed Association, Directed Composition, Generalization, Usage,

Internal Block Diagram: #ibd #internalblockdiagram
-Part Property, Value Property, Reference Property, Constraint Property, Flow Property, Constraint Parameter, Binding Connector, Item Flow, Proxy Port, Full Port, Interface Block

Package Diagram: #pkg #packagediagram
-Package, Package Import, Element Import, Navigation, Start Here Page

Parametric Diagram: #par #parametricdiagram
-Rollup, Constraint Block, Part Property, Value Property, Reference Property, Constraint Property, Flow Property, Constraint Parameter,

SysML Requirement Diagram:

Requirement Diagram: #req #requirementdiagram
-Extended Requirement, Satisfy, Verify, Relationships, ID, Test Case Activity, Trace, Derive, Copy,

SysML Behavioral Diagrams:

Activity Diagram: #act #activitydiagram
-Allocation, Swim Lanes, Swimlanes, Activity Partitions, Actions, Activities, Call Behavior Action, Opaque Action, Control Flow, Object Flow, Send Signal Action, Accept Event Action, Time Event, Initial Node, Activity Final, Flow Final, Decision, Merge, Fork Horizontal, Join Horizontal, Input Pin, Output Pin

State Machine Diagram: #stm #statemachinediagram
Initial, Final State, Composite State, Orthogonal State, Submachine State, Deep History, Transition to Self, Entry Point, Exit Point, Junction, Choice

Sequence Diagram: #seq #sequencediagram
Lifeline, Alternatives, Loop, Option, Call Message, Send Message, Reply Message, Create Message, Delete Message, Diagonal Message, Message to Self, Recursive Message, Lost Message, State Invariant, Duration Constraint

Use Case Diagram: #uc #usecasediagram
-Actor, Use Case, Include, Extend, Association, Generalization, Block,


Visit our website for more available free resources at www.CameoMagic.com

Комментарии

Информация по комментариям в разработке

Похожие видео

  • О нас
  • Контакты
  • Отказ от ответственности - Disclaimer
  • Условия использования сайта - TOS
  • Политика конфиденциальности

video2dn Copyright © 2023 - 2025

Контакты для правообладателей [email protected]