Logo video2dn
  • Сохранить видео с ютуба
  • Категории
    • Музыка
    • Кино и Анимация
    • Автомобили
    • Животные
    • Спорт
    • Путешествия
    • Игры
    • Люди и Блоги
    • Юмор
    • Развлечения
    • Новости и Политика
    • Howto и Стиль
    • Diy своими руками
    • Образование
    • Наука и Технологии
    • Некоммерческие Организации
  • О сайте

Скачать или смотреть UNDERWORLD with KiraBerry & SUBS 🐲 Loot & Robux Giveaway ⚔ Dungeon Quest ► Roblox PRO 🔴 LIVE Rewind

  • Randem Gamor
  • 2019-05-02
  • 1242
UNDERWORLD with KiraBerry & SUBS 🐲 Loot & Robux Giveaway ⚔ Dungeon Quest ► Roblox PRO 🔴 LIVE Rewind
glorioustimelosttimelostunderworldphoenixdualdaggerstitanbeastmasterwarscythespellguardianwarriormagekingcastlefiresoulstealergreatcgshardcorehcinsanenightmarecarryrpgdungeonquestdqswordmmommorpglegendaryepicraregiveawayrobuxrobloxr$newcoolbesthowonlineboygirlfriendgameoldfuncutehappyfunnygamerprotiphacktrickpcmobilexboxswitchandroid2019tseriesfreepewdiepiewinkreekdeeterplaystanqrpmacrazymapstaffkiraberrykiraberry
  • ok logo

Скачать UNDERWORLD with KiraBerry & SUBS 🐲 Loot & Robux Giveaway ⚔ Dungeon Quest ► Roblox PRO 🔴 LIVE Rewind бесплатно в качестве 4к (2к / 1080p)

У нас вы можете скачать бесплатно UNDERWORLD with KiraBerry & SUBS 🐲 Loot & Robux Giveaway ⚔ Dungeon Quest ► Roblox PRO 🔴 LIVE Rewind или посмотреть видео с ютуба в максимальном доступном качестве.

Для скачивания выберите вариант из формы ниже:

  • Информация по загрузке:

Cкачать музыку UNDERWORLD with KiraBerry & SUBS 🐲 Loot & Robux Giveaway ⚔ Dungeon Quest ► Roblox PRO 🔴 LIVE Rewind бесплатно в формате MP3:

Если иконки загрузки не отобразились, ПОЖАЛУЙСТА, НАЖМИТЕ ЗДЕСЬ или обновите страницу
Если у вас возникли трудности с загрузкой, пожалуйста, свяжитесь с нами по контактам, указанным в нижней части страницы.
Спасибо за использование сервиса video2dn.com

Описание к видео UNDERWORLD with KiraBerry & SUBS 🐲 Loot & Robux Giveaway ⚔ Dungeon Quest ► Roblox PRO 🔴 LIVE Rewind

Roblox YouTuber KiraBerry joined us while we played and ran The Underworld Nightmare & Insane difficulty with Subs on Dungeon Quest on Roblox ! :) We did some King's Castle too ! + FREE ITEM & Robux Giveaway ! 100% Real & Legit ! :O Kira Berry joined us around half way through the stream ! :) \o/

Latest awesome Video ! ►    • UNDERWORLD SOLO HARDCORE 👿 ALL BOSSES ⚔ PR...  
https://bit.ly/2SNXMYc ► Awesome Roblox MERCH !

Dungeon Quest is the best Hack 'n' Slash Online MMO RPG On Roblox ! :D Grinding Gear & Levels with Subs ! :O I Carry and Power Level too ! :) Giving away lots of OP Loot ! Underworld ! Castle ! Pirate & Winter ! Insane & Nightmare difficulty ! :O I'm over powered with crazy DPS and high HP ! :O I've got Purple EPIC Timelost Set ! :) Maxed ! + 30.7K Spell Dual Arcane Spelldaggers ! :O I need Glorious Gear & a Phoenix Greatstaff now ! :D
Road to level 100 ! :O Don't forget to Subscribe ! Hit That Bell ! Like & Comment ! :) \o/

😎 Road to 6,000 Subscribers ! :) \o/
► Subscribe 👍 Like 💬 Comment 🔔 Notifications On !
   / @randemgamoruk  
💰 FREE CASH GIVEAWAY 💰 video coming as soon as possible !
I also do Videos ! ► https://bit.ly/2OYiOhH

Donators & Members get Rewards / Perks !
💰 Please Donate ► https://streamlabs.com/randemgamoruk
💎 Become a Member ► https://www.youtube.com/randemgamoruk...
All money is highly appreciated and go towards the cost of my content & giveaways !

RANDEM-GAMOR-YT ⇦ My Epic Games / Fortnite Support a Creator Code !

😎 Please 'Follow' me on Roblox ► https://bit.ly/2QEiyby
Use the link above or search "RandemGamor_YT" under 'players' on Roblox !

😎 Please join my Official Roblox Group ► https://bit.ly/2T77BQR
Use the link above or search "Randem Gamor" under 'groups' on Roblox !

👕 My Official Roblox Merch ► https://bit.ly/2SNXMYc
💎 Those buying Merch will get special Roblox Group Ranks !

👷 My Social Media ! :)
Discord ►   / discord  
Facebook ►   / randemgamor  
Twitter ►   / randemgamor  

🚨 My Robux Giveaway complies with Roblox's T&C's as it comes direct from my group funds aka “an official roblox channel” ie; Method ! + EU Law permits us to gift, trade & sell our digital goods as we can physical goods regardless of any EULA. I am fully allowed to giveaway what is mine as permitted by LAW ! :)

Crazy Upbeat Comedy & Funny Gameplay ! That's what it's all about here ! :) Why watch a boring carrot streamer that doesn't talk you !? When you can come join us and have a good old laugh !? Prepare to be entertained !

I've also got a lot of OP pets to giveaway during giveaway during other streams such as brand New Aquatic update 22 Pets ! + Lucky & Beach Egg Pets ! Shiny Epic & Legendary ! Such as Lucky Overlord ! Phoenix & Marshmallow ! Crabs & Octopus ! Overlord ! Etc ! :) I'm still trying to get Pot O' Gold ! Sea Star & Owo Lord ! :D

https://bit.ly/2PpA7HS ► Amazing Game Deals on Humble Bundle !

I use Streamlabs OBS for Live Streaming & Alerts ! ► https://streamlabs.com/slobs/d/3826312
🔴 This is a Live Rewind of Roblox on PC from Thursday afternoon 2nd May 2019 ! I stream mostly Monday to Saturday starting around 8:00PM (GMT) for approx 3 - 5 Hours. My streams go public the day after so you can watch them again !

💰 Upcoming Free Giveaways ! :O
► Fortnite Llama Plushy Teddy Giveaway (Video coming soon) !
► Real Money / Cash Giveaway (Video coming soon) !
Or V-Bucks for Fortnite !? Maybe R$ Robux for Roblox !? Gift Card !?
More at various milestones ! So Subscribe & Share ! :)
1000 FREE Robux Giveaway video coming soon !
Beastmaster War & Spell Scythe
Purple Titan-Forged Sets
Soulstealer Greatsword
All Maxed ! :O

► Please Share my Content ! :)
Please share my channel & content with the world ! - Online & Real Life :)
http://www.randemgamor.co.uk/ ► Official domain that redirects to this Channel !
http://www.randomgamer.co.uk/ ► Alternative domain that redirects to this Channel !
You can also share my videos / Live streams direct from YouTube too ! :)
You can also share my posts / tweets direct from my Facebook & Twitter pages !

💻 My Main Equipment / System Specifications !
https://amzn.to/2OHbeYQ ► Blue Snowball iCE USB Microphone - Black
https://amzn.to/2KoRAgN ► Intel I7-3770k @ 3.5GHz (8 CPUs)
https://amzn.to/2OIbrv1 ► 16GB Corsair Vengeance 1600 MHz RAM
https://amzn.to/2OHQAYr ► Asus Strix RoG Nvidia GTX 1060 6GB

Background music: https://app.pretzel.rocks/player
Outro Track: Sweet Sunrise - http://bit.ly/1eWGSbT

My videos and live streams are for Entertainment and/or Educational Purposes.
It is covered by copyright law under the Fair Use Act.

#ROBLOX
#DUNGEONQUEST
#GIVEAWAY
#KIRABERRY
#UNDERWORLD
#THEUNDERWORLD
#PHOENIX
#GLORIOUS
#KINGSCASTLE
#ROBUX
#LEGENDARY
#COMEDY
#BUZZZTUBE
#TRENDING
#VARIETY
#GAMING
#PEWDIEPIE
#TSERIES
#BEASTMASTER
#SCYTHE

Комментарии

Информация по комментариям в разработке

Похожие видео

  • О нас
  • Контакты
  • Отказ от ответственности - Disclaimer
  • Условия использования сайта - TOS
  • Политика конфиденциальности

video2dn Copyright © 2023 - 2025

Контакты для правообладателей [email protected]