Скачать или смотреть The incredible leaps of three decades of technology evolution! Chairlift comparison (part 3/3)

The incredible leaps of three decades of technology evolution! Chairlift comparison (part 3/3)

ropewaychairliftseatliftgaraventabartholetcomparisontechnologysystemsmechanicslauchernalplauchneralpcontrol systemsskiingski domaindocumentation

Скачать The incredible leaps of three decades of technology evolution! Chairlift comparison (part 3/3) бесплатно в качестве 4к (2к / 1080p)

У нас вы можете скачать бесплатно The incredible leaps of three decades of technology evolution! Chairlift comparison (part 3/3) или посмотреть видео с ютуба в максимальном доступном качестве.

Для скачивания выберите вариант из формы ниже:

Информация по загрузке:

Cкачать музыку The incredible leaps of three decades of technology evolution! Chairlift comparison (part 3/3) бесплатно в формате MP3:

Если иконки загрузки не отобразились, ПОЖАЛУЙСТА, НАЖМИТЕ ЗДЕСЬ или обновите страницу
Если у вас возникли трудности с загрузкой, пожалуйста, свяжитесь с нами по контактам, указанным в нижней части страницы.
Спасибо за использование сервиса video2dn.com

Описание к видео The incredible leaps of three decades of technology evolution! Chairlift comparison (part 3/3)

In this video series, I'm comparing two chairlifts that are 10m, but over three decades apart. They are located at Lauchernalp and the ski domain's deputy technical manager dedicated an entire day to show me around, let me film everywhere and explain each of the ropeways in great detail.

In this part:

00:00 Introduction
00:30 Control systems - the mechanical brain
08:01 The service track - dealing with broken chairs
08:52 Facts about the rope (cable)
10:17 Garaging
13:10 Acknowledgements

Комментарии

Информация по комментариям в разработке