Logo video2dn
  • Сохранить видео с ютуба
  • Категории
    • Музыка
    • Кино и Анимация
    • Автомобили
    • Животные
    • Спорт
    • Путешествия
    • Игры
    • Люди и Блоги
    • Юмор
    • Развлечения
    • Новости и Политика
    • Howto и Стиль
    • Diy своими руками
    • Образование
    • Наука и Технологии
    • Некоммерческие Организации
  • О сайте

Скачать или смотреть “Dreams” (Tilzer) p. Sterling Trio 1919

  • Antique Archive
  • 2023-06-28
  • 169
“Dreams” (Tilzer) p. Sterling Trio 1919
Antique Archiveantique music archiveantiquemusicantique collectionjazzbebopswingdepression-eratunesvintagevintage music1012141610-inch12-inch14-inch16-inchrecordsdiscsdisksalbumwagnergershwintrioduettenorguitarsaxophonedancingdancevictorcolumbiaoldold recordssidessidewaltzone-stepfrenchgermanyiddishenglishswedish20s1920s30s1930ssongs40s1940s50s1950s60s1960s70s19201930194019501960calmsleepupbeathappyslowsadromanticduo
  • ok logo

Скачать “Dreams” (Tilzer) p. Sterling Trio 1919 бесплатно в качестве 4к (2к / 1080p)

У нас вы можете скачать бесплатно “Dreams” (Tilzer) p. Sterling Trio 1919 или посмотреть видео с ютуба в максимальном доступном качестве.

Для скачивания выберите вариант из формы ниже:

  • Информация по загрузке:

Cкачать музыку “Dreams” (Tilzer) p. Sterling Trio 1919 бесплатно в формате MP3:

Если иконки загрузки не отобразились, ПОЖАЛУЙСТА, НАЖМИТЕ ЗДЕСЬ или обновите страницу
Если у вас возникли трудности с загрузкой, пожалуйста, свяжитесь с нами по контактам, указанным в нижней части страницы.
Спасибо за использование сервиса video2dn.com

Описание к видео “Dreams” (Tilzer) p. Sterling Trio 1919

Disclaimer: Some of the content featured on Antique Archive may be sensitive and may or may not be the opinions, ideas, or beliefs of the viewers and/or owner-operator of the channel. The owner-operator of Antique Archive does not endorse the information featured on its YouTube page, likewise, the materials contained within the Antique Archive Youtube page do not represent the opinions of its viewers and/or owner-operator. While the Antique Archive Youtube page contains materials that may be considered prejudiced, stereotyped, or offensive, it should be remembered that folk data is an important resource in the study of both past and contemporary cultures. The owner-operator of Antique Archive takes the Youtube page’s responsibility as a collection of such material seriously. All individuals who wish to use materials featured on the Antique Archive Youtube page are individually required to observe and conform to all copyright laws subject to them.

“Dreams” (Harry von Tilzer) male trio with orchestra accompaniment performed by the Sterling Trio 1919. A2717 78304 Columbia Graphophone Company. Recorded 1919/02/18 New York, New York, United States recording take number 3

Sourced from the Library of Congress: https://www.loc.gov/item/jukebox-660649/
Copyright falls within the Public Domain:
https://www.pdinfo.com/copyright-law/...
https://www.copyright.gov/music-moder...

Комментарии

Информация по комментариям в разработке

Похожие видео

  • О нас
  • Контакты
  • Отказ от ответственности - Disclaimer
  • Условия использования сайта - TOS
  • Политика конфиденциальности

video2dn Copyright © 2023 - 2025

Контакты для правообладателей [email protected]