Logo video2dn
  • Сохранить видео с ютуба
  • Категории
    • Музыка
    • Кино и Анимация
    • Автомобили
    • Животные
    • Спорт
    • Путешествия
    • Игры
    • Люди и Блоги
    • Юмор
    • Развлечения
    • Новости и Политика
    • Howto и Стиль
    • Diy своими руками
    • Образование
    • Наука и Технологии
    • Некоммерческие Организации
  • О сайте

Скачать или смотреть Short update to my Whistle Activated Key Finder Electric Car

  • GrandadIsAnOldMan
  • 2014-02-12
  • 1777
Short update to my Whistle Activated Key Finder Electric Car
grandadfunrubbishgarbagejunkscrapwasteharvestscavengerecycleupcyclerecyclingrepurposehackdisassembleplasticcardboardCDDVDVHScassettetapehotglueelectricpowermotorengine555 timerdelaywhistlekey findercar
  • ok logo

Скачать Short update to my Whistle Activated Key Finder Electric Car бесплатно в качестве 4к (2к / 1080p)

У нас вы можете скачать бесплатно Short update to my Whistle Activated Key Finder Electric Car или посмотреть видео с ютуба в максимальном доступном качестве.

Для скачивания выберите вариант из формы ниже:

  • Информация по загрузке:

Cкачать музыку Short update to my Whistle Activated Key Finder Electric Car бесплатно в формате MP3:

Если иконки загрузки не отобразились, ПОЖАЛУЙСТА, НАЖМИТЕ ЗДЕСЬ или обновите страницу
Если у вас возникли трудности с загрузкой, пожалуйста, свяжитесь с нами по контактам, указанным в нижней части страницы.
Спасибо за использование сервиса video2dn.com

Описание к видео Short update to my Whistle Activated Key Finder Electric Car

A few weeks back I made this Whistle activated Key Finder Electric Car with a very basic circuit taking the signal generated to make the key finder beep and using it to drive an electric motor. At the end of the video it was clear the circuit could be improved, certainly a short delay timer in the circuit to hold the motor on rather than just reacting to the pulsing beeps would make more sense. In tonight's episode I use a 555 timer to provide a delay to smooth out the pulses from the beeps.
The key finder uses a sequence of beeps that I could probably build a counter to combine into a single pulse, so there is still room for improvement but I probably will leave it alone and move on to something else.

If you have a question it is probably worth reading this video description first because the answer may already be here. To help you find my videos I made a YouTube search guide video    • YouTube App Search and Video Description   or checkout my playlists page https://www.youtube.com/user/GrandadI...

The first attempt at this project is here    • Whistle Activated Key Finder Electric Car  

This is a handy video by El profe García on using a 555 timer if you can handle Spanish    • Circuito de Retardo - (Como se hace) Inversor  

Main Components
-
Whistle Activated Key Finder
2 x 2N2222 transistor
1 x 555 timer
1 x 100K resistor
1 x 100K variable resistor
1 x 1K resistor
1 x 47 microfarad electrolytic capacitor
1 LED
1 diode
1 relay
1 small electric motor
1 x 9v battery
1 x AA battery and holder
I think that is about all the main items + the rubber band powered car I converted

The original build video is here    • Whistle Activated Key Finder Electric Car  

Some related playlists
Electronic projects    • Electronic projects  
Charity Shop Gold or Garbage    • Charity Shop Gold or Garbage?  
Things you can make from an old DVD drive    • Things you can make from an old DVD drive  
Bargain Store Projects    • Bargain Store Projects  

Filmed using FujiFilm FinePix S4800
Edited using Serif MoviePlus Starter Edition

I have thousands of videos on YouTube covering a wide range of subjects. To find them follow my search guides    • YouTube App Search and Video Description   or    • How to search for my YouTube Videos   or see my playlists page https://www.youtube.com/user/GrandadI...
Generally my projects are for my grandchildren to enjoy. OK, I enjoy them too. If anybody else likes them, that is a bonus. I like to keep my work as simple and basic as possible so that it can be copied easily and improved by anybody who wants to try themselves. I recycle or repurpose items rather than buy new and when I do buy I like to keep it cheap.
   / grandadisanoldman  

Комментарии

Информация по комментариям в разработке

Похожие видео

  • О нас
  • Контакты
  • Отказ от ответственности - Disclaimer
  • Условия использования сайта - TOS
  • Политика конфиденциальности

video2dn Copyright © 2023 - 2025

Контакты для правообладателей [email protected]