Logo video2dn
  • Сохранить видео с ютуба
  • Категории
    • Музыка
    • Кино и Анимация
    • Автомобили
    • Животные
    • Спорт
    • Путешествия
    • Игры
    • Люди и Блоги
    • Юмор
    • Развлечения
    • Новости и Политика
    • Howto и Стиль
    • Diy своими руками
    • Образование
    • Наука и Технологии
    • Некоммерческие Организации
  • О сайте

Скачать или смотреть Chalet Emily – Luxury Alpine Living in the Heart of Villars/Gryon - Swiss Alps

  • Sven Dutoit - Sotheby's International Realty
  • 2025-07-28
  • 552
Chalet Emily – Luxury Alpine Living in the Heart of Villars/Gryon - Swiss Alps
chaletsalespropertysalesrealestaterealestatevideopropertyvideochaletvideovillarsleysinlesdiableretsgryonskiresortsluxurylifestylealpinechaletbarnessothebysrealtycompassspgonechristiesforbesfigarocoldwellbankerfinancialtimesnytimesswissalpsrelocationinternationalschoolsswissrealestatemountainlifestylemansionhouselogcabincabinpornskiinskiout
  • ok logo

Скачать Chalet Emily – Luxury Alpine Living in the Heart of Villars/Gryon - Swiss Alps бесплатно в качестве 4к (2к / 1080p)

У нас вы можете скачать бесплатно Chalet Emily – Luxury Alpine Living in the Heart of Villars/Gryon - Swiss Alps или посмотреть видео с ютуба в максимальном доступном качестве.

Для скачивания выберите вариант из формы ниже:

  • Информация по загрузке:

Cкачать музыку Chalet Emily – Luxury Alpine Living in the Heart of Villars/Gryon - Swiss Alps бесплатно в формате MP3:

Если иконки загрузки не отобразились, ПОЖАЛУЙСТА, НАЖМИТЕ ЗДЕСЬ или обновите страницу
Если у вас возникли трудности с загрузкой, пожалуйста, свяжитесь с нами по контактам, указанным в нижней части страницы.
Спасибо за использование сервиса video2dn.com

Описание к видео Chalet Emily – Luxury Alpine Living in the Heart of Villars/Gryon - Swiss Alps

Connect to Whatsapp Channel: https://whatsapp.com/channel/0029Vb7A...

Price: 4'500'000 CHF

Chalet Emily – Luxury Alpine Living in the Heart of Villars-sur-Ollon

Set within a vast private park with breathtaking views of the Alps, Chalet Emily is an exceptional property recently renovated in 2018, combining modern comfort with timeless alpine charm. Located in the desirable La Barboleuse area, the chalet is just a 10-minute drive from the center of Villars-sur-Ollon, offering quick access to international schools, sports facilities, wellness centers, and shopping.

The chalet is perfectly positioned for ski enthusiasts, with direct access to the Villars / Gryon / Les Diablerets ski domain via the Les Chaux cable car. This world-class ski area spans over 125 km of pistes suitable for all levels, connecting the cosmopolitan resort of Villars with Gryon, Les Diablerets, and Glacier 3000, offering ski-in / ski-out convenience and exceptional alpine experiences.

Inside, Chalet Emily features spacious open-plan living areas filled with natural light and designed to maximize the panoramic Alpine views. The master suite is a true retreat, boasting two dressing rooms and en-suite bathrooms, while additional bedrooms provide comfort and privacy for family and guests. The chalet also includes a fully equipped kitchen, office, and versatile living spaces ideal for entertaining or relaxing.

The outdoor amenities are equally impressive: a large green park, a heated outdoor swimming pool, sauna, and playground provide luxury, leisure, and recreation for all ages. The chalet’s elevated position ensures sunshine throughout the day, creating a bright and inviting atmosphere.

Villars-sur-Ollon itself is a four-season resort, known for its vibrant après-ski, international community, and diverse activities. In summer, the area offers hiking, mountain biking, golf, and paragliding, while in winter it becomes a hub for skiing, snowboarding, and cross-country trails. Its proximity to Geneva and Lausanne makes it easily accessible while maintaining a secluded alpine charm.

Chalet Emily is available as a primary or secondary residence, providing a rare opportunity to own a prestigious home in one of Switzerland’s top ski resorts. This property perfectly combines luxury, privacy, and an unrivaled Alpine lifestyle.

Sven Dutoit
Switzerland Sotheby’s International Realty – Villars-sur-Ollon
📞 +41 79 675 12 66
📧 [email protected]

#switzerland #suisse #schweiz #svizzera #realestate #proerty #chalet #home #house #dreamhome #dreamchalet #dreamproperty #swisschaletsale #villars #villarssurollon #vaud #alps #swissproperty #homebuyers #pov #skiinskiout #swimmingpool #spa
#luxurylifestyle #youtubeshorts #youtubevideo #home #house #skiinskiout #gryon #villars #villarssurollon #1of1 #luxuryoutlook #nothingcompares #sothebysinternationalrealty #new #listing #relocation #swissalps #tv #switzerlandsothebysrealty

Комментарии

Информация по комментариям в разработке

Похожие видео

  • О нас
  • Контакты
  • Отказ от ответственности - Disclaimer
  • Условия использования сайта - TOS
  • Политика конфиденциальности

video2dn Copyright © 2023 - 2025

Контакты для правообладателей [email protected]