Logo video2dn
  • Сохранить видео с ютуба
  • Категории
    • Музыка
    • Кино и Анимация
    • Автомобили
    • Животные
    • Спорт
    • Путешествия
    • Игры
    • Люди и Блоги
    • Юмор
    • Развлечения
    • Новости и Политика
    • Howto и Стиль
    • Diy своими руками
    • Образование
    • Наука и Технологии
    • Некоммерческие Организации
  • О сайте

Скачать или смотреть Banana Bread Cupcakes! 🍌🧁 Raw Vegan Dessert Recipe! Sweet, Gooey, No Bake, & Delicious!

  • FullyRawKristina
  • 2025-04-12
  • 22464
Banana Bread Cupcakes! 🍌🧁 Raw Vegan Dessert Recipe! Sweet, Gooey, No Bake, & Delicious!
veganveganismjuicingjuicingrecipesjuicerbestjuicerkitchencookingplantbasedhealthyvegansfullyrawfullyrawkristinalifestylejuicerecipeweightlossdetoxcleaneatingeatrawveganrawfoodrawdietvegetariantransformationwhatiatetodaykristinafullyrawnamanamajuicerjuicerreviewjuicerecipesgreenjuicebeginnertipswellnessveganmealsdessertcakecheesecakebirthdaycakedessertrecipescupcakecupcakescarrotcakecarrotcarrotcupcakezerowastenobakeyumbitesbananabreadspring
  • ok logo

Скачать Banana Bread Cupcakes! 🍌🧁 Raw Vegan Dessert Recipe! Sweet, Gooey, No Bake, & Delicious! бесплатно в качестве 4к (2к / 1080p)

У нас вы можете скачать бесплатно Banana Bread Cupcakes! 🍌🧁 Raw Vegan Dessert Recipe! Sweet, Gooey, No Bake, & Delicious! или посмотреть видео с ютуба в максимальном доступном качестве.

Для скачивания выберите вариант из формы ниже:

  • Информация по загрузке:

Cкачать музыку Banana Bread Cupcakes! 🍌🧁 Raw Vegan Dessert Recipe! Sweet, Gooey, No Bake, & Delicious! бесплатно в формате MP3:

Если иконки загрузки не отобразились, ПОЖАЛУЙСТА, НАЖМИТЕ ЗДЕСЬ или обновите страницу
Если у вас возникли трудности с загрузкой, пожалуйста, свяжитесь с нами по контактам, указанным в нижней части страницы.
Спасибо за использование сервиса video2dn.com

Описание к видео Banana Bread Cupcakes! 🍌🧁 Raw Vegan Dessert Recipe! Sweet, Gooey, No Bake, & Delicious!

🫐 Get the NEW Vitamix X5 & FREE SHIPPING here: https://www.kqzyfj.com/click-8479771-... This link will take you to their best discounts!
🍌 Vitamix machines, accessories, & discounts here: https://www.anrdoezrs.net/click-84797...

🍒 Get 20% OFF my FullyRaw recipe app! iPhone users download here: https://itunes.apple.com/us/app/fully...
🍓 Download my recipe app on Android here: https://play.google.com/store/apps/de...

🍊 Get $55 OFF a Nama J2 juicer using the code: FULLYRAW55 at checkout here: https://bit.ly/namaj2 This code also gives you an additional 10% OFF all accessories. Payment plans are available with a 15-year warranty!

🌱 Get 15-30% off Sunwarrior's Plant-Based Protein, Supplements, and Magnesium using this link: https://bit.ly/sunwarriorveganproducts or the code: FULLYRAW at checkout.

🍇 Join my Inner Circle community here and get access to our private bi-weekly Zoom calls: https://innercircle.fullyraw.com

🌺 Please follow my Instagram here at   / fullyrawkristina  

🍍 Download your FREE e-Book on 5 Ways to Go Raw Vegan here: https://www.fullyraw.com/5-easy-steps...

🍍 Download my FREE e-book 'A Beginner's Guide to Juicing' here: https://fullyraw.mykajabi.com/beginne...

🍉 Join the 21-Day Vegan & Juicing Challenge here: https://challenge.fullyraw.com

🍉 How to Start a Raw Food Diet video here:    • How to Eat a Raw Vegan Diet 🍉 Easy Transit...  

🍍 BLOG POST with all of my favorite supplements & recommendations I LOVE: https://www.fullyraw.com/blog/supplem...

🌱 Global Healing Center Raw Vegan Supplements (B12 & D3): https://go.globalhealingcenter.com/LP...

🌱 Best quality organic and non-GMO gardening seeds from True Leaf Market here: http://bit.ly/trueleafgardenseeds
🌱 Sprouting Seeds I LOVE (12 lb. Bulk Set): https://bit.ly/trueleaf12lbset
🌱 Get the FullyRaw Sprouting Seed Kit here: https://bit.ly/fullyrawsproutingkit Organic & Non-GMO!
🌱 Easy Sprouting Starter Kit (Jars Included): https://bit.ly/sproutingstarterkit
🌱 More Sprouting Jars: https://amzn.to/37vEqvQ
🌱 Microgreens Beginner's Growing Kit: https://bit.ly/microgreenbeginnerskit

🌱 Planting 700 Trees & My Property Transformation video here:    • 700+ Fruit Trees Planted! 🌴 Before & After...  

🍊 What's the BEST Juicer? Nama Juicer Comparison Video Here:    • What's the BEST JUICER? 🍊Top 2 Cold-Presse...  
🫐 Additional Nama Juicer Comparison Video Here:    • What's the BEST Juicer & EASIEST to Clean?...  
& Honest Review Here:    • Honest Nama Juicer Review 🌱 Answering ALL ...  

☀️🔋 Get $100 OFF an Ideal Living Solar Panel & Power Station here: https://bit.ly/solarpanelpowerstation

💧 Get $100 OFF an AquaTru Water Purification System: https://bit.ly/fullyrawaquatru

💧 Get 50% off the Air Doctor Purifier Here: https://bit.ly/airdoctorhome

💧If you're interested in a Clearlight Sauna, please email [email protected] and let them know Kristina sent you. It's an infrared sauna with full-spectrum light therapy...and it's amazing!

💧 Get 50% off the Air Doctor Purifier Here: https://bit.ly/airdoctorhome

📚 Buy my published book: http://www.tinyurl.com/fullyrawbook

🛍️ Check out my online store: https://www.fullyraw.com/shop

☀️ My website & online programs here: http://fullyraw.com/

Follow Me:
Subscribe: http://bit.ly/FRKsub
Follow my FB:   / fullyrawkristina  
Follow My Instagram:   / fullyrawkristina  
Twitter:   / fullyraw  
Pinterest:   / fullyraw  
Tik Tok: @fullyrawkristina

Follow My Other Channels:
RawfullyOrganic:    / rawfullyorganic  
FullyRaw en Español:    / fullyraw en español  

Official Website: http://fullyraw.com/

About FullyRawKristina:
Kristina Carrillo-Bucaram lives to inspire a FullyRaw, or 100% raw vegan healthy vegan lifestyle at www.fullyraw.com. A raw vegan lifestyle incorporates fruits, vegetables, nuts, and seeds. KristinaFullyRaw posts new videos every week that include recipes, tips, tricks, vlogs, motivation, fitness, exercise, and inspiration on how to be the best version of yourself!

Disclaimer: I am not a doctor. Please always consult with your medical practitioner for your own health needs and requirements.

---------------------
Time Codes:
0:00 Intro
0:54 Banana Bread Cupcakes
1:12 Equipment
2:36 Cupcake Base Recipe
5:09 Cashew Icing
6:55 Caramel Drizzle
7:57 Outro

#vegan #recipes #dessert #rawvegan #health #plantbased #healthy

Комментарии

Информация по комментариям в разработке

Похожие видео

  • О нас
  • Контакты
  • Отказ от ответственности - Disclaimer
  • Условия использования сайта - TOS
  • Политика конфиденциальности

video2dn Copyright © 2023 - 2025

Контакты для правообладателей [email protected]