Logo video2dn
  • Сохранить видео с ютуба
  • Категории
    • Музыка
    • Кино и Анимация
    • Автомобили
    • Животные
    • Спорт
    • Путешествия
    • Игры
    • Люди и Блоги
    • Юмор
    • Развлечения
    • Новости и Политика
    • Howto и Стиль
    • Diy своими руками
    • Образование
    • Наука и Технологии
    • Некоммерческие Организации
  • О сайте

Скачать или смотреть Ouranosmon vs Omnimon [Digimon TCG BT22 Exhibition Match] Match Commentary

  • KnTElixar
  • 2025-08-11
  • 2135
Ouranosmon vs Omnimon [Digimon TCG BT22 Exhibition Match] Match Commentary
DigimonGameTCGClose GameClutchArmour RushArmor RushArmorVeemonClutch MatchVoice OverDPP ChannelDPP#DigimonTCG#KnTElixarDigimonTCGKnTElixarbeelzemonmother d reaperbonus contentanubismonbagra armymtggirlmeatykageprimitivekageluisthepandaLocal FinalsBagra Huntersblue flareallianceterriermonEnglish DigimonMatch Commentaryesports.netesportsdotnetUK DigimonFanboy3Pod Squad PodcastPod SquadbeckmonDigimon PodcastPodcast
  • ok logo

Скачать Ouranosmon vs Omnimon [Digimon TCG BT22 Exhibition Match] Match Commentary бесплатно в качестве 4к (2к / 1080p)

У нас вы можете скачать бесплатно Ouranosmon vs Omnimon [Digimon TCG BT22 Exhibition Match] Match Commentary или посмотреть видео с ютуба в максимальном доступном качестве.

Для скачивания выберите вариант из формы ниже:

  • Информация по загрузке:

Cкачать музыку Ouranosmon vs Omnimon [Digimon TCG BT22 Exhibition Match] Match Commentary бесплатно в формате MP3:

Если иконки загрузки не отобразились, ПОЖАЛУЙСТА, НАЖМИТЕ ЗДЕСЬ или обновите страницу
Если у вас возникли трудности с загрузкой, пожалуйста, свяжитесь с нами по контактам, указанным в нижней части страницы.
Спасибо за использование сервиса video2dn.com

Описание к видео Ouranosmon vs Omnimon [Digimon TCG BT22 Exhibition Match] Match Commentary

You telling me a Squid fried this rice? ウラノスモン vs オメガモン | Want to dodge the ads? Consider hatching a Digi Egg of Membership.
   / @kntelixar  
EXPAND ME!
Watch the Shoutmon Video -    • How GOOD was Shoutmon ACTUALLY? - History ...  
Join the Discord -   / discord  

Unlock your Baki Body with Player Ammo's Premium 50:50 Blend Protein, and Energy Drinks. https://www.playerammo.com/?ref=Elixar for 10% off your order. Check out the Baki Collaboration!

00:00 Game 1
05:05 Game 2 and onwards

If you're interested in supporting the growth of the channel, you can support the twitch here:   / kntelixar  
EUROPE! If you're considering buying singles add my code "Elixar" during registration at https://www.cardmarket.com to help fund building new decks on the channel!

SUBSCRIBE ➤    / @kntelixar  

Socials ➤
Twitter:   / kntelixar  
Twitch:   / kntelixar  
Instagram:   / kntelixar  
Medal: https://medal.tv/u/KnTElixar

Gear ➤ Amazon Associates List (I make a little off of any purchase from this)

Main Capture Card - https://amzn.to/3R1VLmi
Main Camera (Mark 2) - https://amzn.to/3OVX1FI
Second Camera (a5000) - https://amzn.to/3umEYRk
Camera Arm - https://amzn.to/3yyllbj
Overhead Arm - https://amzn.to/3OXKTE5

Main Mouse - https://amzn.to/3bMHeur
Secondary Mouse - https://amzn.to/3ufmgLl

Headphones (recent equivalent) - https://amzn.to/3Pfkbam
Interface - https://amzn.to/3ujBu1R
Gain Booster - https://amzn.to/3bEwTAN
Mic (non X version) - https://amzn.to/3yCO66T
Mic Arm - https://amzn.to/3AiDbjW
Softbox Lighting - https://amzn.to/3Ihn0p6
Cheap "Cam Link" - https://amzn.to/3Oy1Sx3
External Capture Card - https://amzn.to/3y9BMJH

DigimonTCG
#kntelixar #digimontcg #digimon #tcg #cardgames #tabletop #black #blackcreators #nigerian #nigerianprince #nigeriancreators #dirkling #dirklings #security #control #securitycontrol #armour #armor #armorrush #veemon #clutch #finalturn #digimoncarddev #dorbickmon
#bluedorbickmon #blackdorbickmon #bluehybrid #hybrid #dobickmonblue #dobickmonotk #otk #raguelmon #meiko #digimonadventuretri #digimonadventure2020 #ragnaloardmon #xantibody #ragnaloardmonxantibody #purplehybrid #cherubimon #cherubim #blackhybrid #hybrid #dragon #dragonball #dragonlinkz #yugioh #linkmonster #links #linksummon #jesmon #jesus #bandai #primitivekage #avault #digipanda #theegman #omnimon #darkknightmon #imperialdramon #skullknight #imperial #sukamon
#suka #mirage #miragegaogamon #miragegameplay #gaogamon #burstmode #burst #jellymon #nonbinary #nonbinaryartist #localmatch #mastemon #angewomon #ladydevimon #devimon #devilmancrybabyedit #redhybrid #takuya #emperorgreymon #emperor #kntelixarbagra #bagrahunters #localmatch #localfinals #localgamestore #matchcommentary #sukamon #kingsukamon #king #etemon #elvis #hybrid #takuya #blueflare #bluehybrid #kuzuhamon #alliance #terriermon #mirage #miragegameplay #miragegaogamon #ex4 #burstmode #kuzuha #chaosgallantmon #gallantmon #dukemon #megidramon #megimill #millloop #deckout #libraryout
#library #jesmon #seekers #digimonseekers #digimonsurvive #otk #shinegreymon #marcus #victory #victorygreymon #gallantmon #ragnaloardmon #zubamon #ukdigimon 'fanboy3 #podsquadpodcast #podsquad #digimonpodcast #podcast

Комментарии

Информация по комментариям в разработке

Похожие видео

  • О нас
  • Контакты
  • Отказ от ответственности - Disclaimer
  • Условия использования сайта - TOS
  • Политика конфиденциальности

video2dn Copyright © 2023 - 2025

Контакты для правообладателей [email protected]