Logo video2dn
  • Сохранить видео с ютуба
  • Категории
    • Музыка
    • Кино и Анимация
    • Автомобили
    • Животные
    • Спорт
    • Путешествия
    • Игры
    • Люди и Блоги
    • Юмор
    • Развлечения
    • Новости и Политика
    • Howto и Стиль
    • Diy своими руками
    • Образование
    • Наука и Технологии
    • Некоммерческие Организации
  • О сайте

Скачать или смотреть Titan’s Tri-Immune Blend Therapy: Injectable Vitamin C, Zinc & GSH!

  • Titan Medical Center
  • 2021-11-17
  • 596
Titan’s Tri-Immune Blend Therapy: Injectable Vitamin C, Zinc & GSH!
Hormone replacement therapyHRTtestosteroneinjectable vitamins and amino acidsweight losstitanmedicaltitanmedicaltherapiesHormonesbloodworkvitaminsaminoacidsamino acidspeptideslifestylehealthlabtestslabresultsmalehormonesfemalehormoneslowtmenopauseandropausefatigueadrenalsthyroidestrogenfeelgoodagaincortisolrestfulsleephealthandwellnessagemanagementoptimalwellnessfitnessclinicgymexercisemusclemodelstsikourisvitamin czincglutathione
  • ok logo

Скачать Titan’s Tri-Immune Blend Therapy: Injectable Vitamin C, Zinc & GSH! бесплатно в качестве 4к (2к / 1080p)

У нас вы можете скачать бесплатно Titan’s Tri-Immune Blend Therapy: Injectable Vitamin C, Zinc & GSH! или посмотреть видео с ютуба в максимальном доступном качестве.

Для скачивания выберите вариант из формы ниже:

  • Информация по загрузке:

Cкачать музыку Titan’s Tri-Immune Blend Therapy: Injectable Vitamin C, Zinc & GSH! бесплатно в формате MP3:

Если иконки загрузки не отобразились, ПОЖАЛУЙСТА, НАЖМИТЕ ЗДЕСЬ или обновите страницу
Если у вас возникли трудности с загрузкой, пожалуйста, свяжитесь с нами по контактам, указанным в нижней части страницы.
Спасибо за использование сервиса video2dn.com

Описание к видео Titan’s Tri-Immune Blend Therapy: Injectable Vitamin C, Zinc & GSH!

Check out our video on our #immune system #boosting Titan therapy that includes injectable Vitamin C, Zinc & GSH. This therapy can help #strengthen your body from the inside out!

VITAMIN C
This vitamin is well known for its immune-boosting power!
Vitamin C plays an integral role in the manufacturing and performance of our white blood cells. It's also an antioxidant, which means it can reverse oxidative stress - essentially the aging process of the body by removing toxins from the body. Vitamin C boosts the immune system as well as overall health.

ZINC
Zinc is great for the immune system, skin health & wound healing!
The body’s immune system needs zinc to do its job. Zinc is considered an essential nutrient, meaning that your body can’t produce or store it. It’s also required for numerous processes in your body, including: Gene expression - Enzymatic reactions - Immune function - Protein & DNA synthesis - Growth & Development

GLUTATHIONE
The mother of all antioxidants!
Glutathione is contained within our bodies & acts as a buffer for any harmful toxins, chemicals or damaged cells that are introduced. The body is capable of producing its own glutathione, which keeps the body healthy & functioning properly.
It can be depleted rather quickly if a person is sick, has been working out hard as well as drinking or smoking which can lead to more illnesses. Glutathione can also help with workout recovery & those leading active lifestyles.
**You do NOT need to have blood work done to get these therapies**


Click here for our full list of social media & much more info!
https://linktr.ee/TitanMedicalCenter

We offer Hormone Replacement Therapy, #Medical #Weight Loss, #Injectable #Vitamin & #Amino #Therapies, #Relationship Bedroom #Enhancing Therapies, On-Site or #Nationwide #Blood Work Testing, #Peptide Therapies, In-House #IV Therapy, & Primary Care. We are based in #Tampa, #Florida but YES we service NATIONWIDE!

We can help you enhance your life and performance while operating at optimal health levels. We have licensed medical providers and start with blood work testing to get you on the right track! Some of our therapies are available without blood work testing.

Call Titan Medical Center to learn how you can have a healthier, stronger life. We offer telemedicine (via FaceTime or Skype) from the comfort of your own home.
Our Titan therapies are doctor prescribed & shipped directly to your doorstep from a U.S. licensed pharmacy!

727-389-3220 or http://titanmedicalcenter.com/
Follow us on
FACEBOOK:   / titanmedicalcenter  
INSTAGRAM:   / titanmedical  
TWITTER:   / titanmedicalcen  

Комментарии

Информация по комментариям в разработке

Похожие видео

  • О нас
  • Контакты
  • Отказ от ответственности - Disclaimer
  • Условия использования сайта - TOS
  • Политика конфиденциальности

video2dn Copyright © 2023 - 2025

Контакты для правообладателей [email protected]