Logo video2dn
  • Сохранить видео с ютуба
  • Категории
    • Музыка
    • Кино и Анимация
    • Автомобили
    • Животные
    • Спорт
    • Путешествия
    • Игры
    • Люди и Блоги
    • Юмор
    • Развлечения
    • Новости и Политика
    • Howto и Стиль
    • Diy своими руками
    • Образование
    • Наука и Технологии
    • Некоммерческие Организации
  • О сайте

Скачать или смотреть Cucumber Chickpea Salad

  • Matt Santos
  • 2024-04-28
  • 772093
Cucumber Chickpea Salad
SaladFoodcookingrecipeeasyhealthymealsidevegetableschickpeascucumbertomato
  • ok logo

Скачать Cucumber Chickpea Salad бесплатно в качестве 4к (2к / 1080p)

У нас вы можете скачать бесплатно Cucumber Chickpea Salad или посмотреть видео с ютуба в максимальном доступном качестве.

Для скачивания выберите вариант из формы ниже:

  • Информация по загрузке:

Cкачать музыку Cucumber Chickpea Salad бесплатно в формате MP3:

Если иконки загрузки не отобразились, ПОЖАЛУЙСТА, НАЖМИТЕ ЗДЕСЬ или обновите страницу
Если у вас возникли трудности с загрузкой, пожалуйста, свяжитесь с нами по контактам, указанным в нижней части страницы.
Спасибо за использование сервиса video2dn.com

Описание к видео Cucumber Chickpea Salad

Cucumber Chickpea Salad 🥗🥒🍅

Follow @drmattcooks for more recipes!

One of my favorite recipes for the warmer weather because it’s light, refreshing, and goes well with any dish! I love the crisp texture and protein from the chickpeas. Scoop it up with some tortilla chips or add it on top of a rice bowl. Sharpen your knife and enjoy!

Ingredients:
-1 16oz. can of chickpeas, strained
-2 Roma tomatoes, small diced
-1 medium cucumber, small diced
-1 small red onion, small diced
-fresh lime juice
-salt to taste
-finely chopped cilantro

Instructions:
-add all of the ingredients into a large bowl
-mix it all together and give it a taste; adjust flavors to your liking
-allow to chill in the fridge for at least 2 hours
-enjoy!

#salad #cucumber #chickpeas #tomato #saladrecipe #easyrecipes #refreshing #healthyfood #cleaneating #healthyrecipes #eatyourveggies #plantbased #eatclean #eathealthy #dietfood #homecook #foodie

Комментарии

Информация по комментариям в разработке

Похожие видео

  • Homemade Chipotle Chicken Bowl
    Homemade Chipotle Chicken Bowl
    1 год назад
  • Easy Chickpea Salad #shorts
    Easy Chickpea Salad #shorts
    3 года назад
  • Easy Chickpea Salad (lunch idea in 15 minutes)
    Easy Chickpea Salad (lunch idea in 15 minutes)
    2 года назад
  • Chickpea salad with Creamy Dressing
    Chickpea salad with Creamy Dressing
    3 года назад
  • Mediterranean Chickpea Salad Recipe | Balela Salad
    Mediterranean Chickpea Salad Recipe | Balela Salad
    1 год назад
  • Your new FAVORITE salad
    Your new FAVORITE salad
    1 год назад
  • Chickpea Salad
    Chickpea Salad
    1 год назад
  • This chickpea curry is underrated
    This chickpea curry is underrated
    1 год назад
  • О нас
  • Контакты
  • Отказ от ответственности - Disclaimer
  • Условия использования сайта - TOS
  • Политика конфиденциальности

video2dn Copyright © 2023 - 2025

Контакты для правообладателей [email protected]