Logo video2dn
  • Сохранить видео с ютуба
  • Категории
    • Музыка
    • Кино и Анимация
    • Автомобили
    • Животные
    • Спорт
    • Путешествия
    • Игры
    • Люди и Блоги
    • Юмор
    • Развлечения
    • Новости и Политика
    • Howto и Стиль
    • Diy своими руками
    • Образование
    • Наука и Технологии
    • Некоммерческие Организации
  • О сайте

Скачать или смотреть Storing Meal Prep and Keeping it Fresh

  • Matt Santos
  • 2024-07-24
  • 333036
Storing Meal Prep and Keeping it Fresh
FoodRecipemealmealsrecipescookingcookstoragefreshkitchenhackadvicetipseasybudgetmeal prep
  • ok logo

Скачать Storing Meal Prep and Keeping it Fresh бесплатно в качестве 4к (2к / 1080p)

У нас вы можете скачать бесплатно Storing Meal Prep and Keeping it Fresh или посмотреть видео с ютуба в максимальном доступном качестве.

Для скачивания выберите вариант из формы ниже:

  • Информация по загрузке:

Cкачать музыку Storing Meal Prep and Keeping it Fresh бесплатно в формате MP3:

Если иконки загрузки не отобразились, ПОЖАЛУЙСТА, НАЖМИТЕ ЗДЕСЬ или обновите страницу
Если у вас возникли трудности с загрузкой, пожалуйста, свяжитесь с нами по контактам, указанным в нижней части страницы.
Спасибо за использование сервиса video2dn.com

Описание к видео Storing Meal Prep and Keeping it Fresh

How I Store and Keep Meal Prep Fresh 🍗🍚🍝

Showing you all how I store meals in the fridge and freezer to maximize flavor and freshness!

1.) whatever I plan to eat within the next 3-4 days goes straight into the fridge
2.) the rest of the meals go into the freezer, where they can last up to 6 months
3.) pick a meal from the fridge and reheat it in the microwave; I keep the lid on and slightly off-center to allow the meal to steam
4.) transfer a meal from the freezer to the fridge and place it in the back of the line; this gives it 1-2 days to defrost before reheating
5.) as I cook fresh meals for dinners throughout the week, I turn leftovers into extra meal prep
6.) I add these extra meals into the freezer and fridge to create even more of a variety
7.) I try to meal prep 2-3 different meals a week in addition to cooking 2-3 fresh homemade dinners a week; this gives us at least 4-6 different meals to choose from
8.) repeat the cycle and enjoy!

#mealprep #meal #mealplan #mealprepping #mealplanning #healthyfood #recipes #eatclean #healthyeating #cookingtips #kitchenhacks #food #lunch #mealtime #lunchtime #freshfood

Комментарии

Информация по комментариям в разработке

Похожие видео

  • Homemade Chipotle Chicken Bowls
    Homemade Chipotle Chicken Bowls
    1 день назад
  • Want Delicious High Protein Meals? Try This Garlic Parmesan Steak Alfredo Pasta Meal Prep🥩🧀🔥 #recipe
    Want Delicious High Protein Meals? Try This Garlic Parmesan Steak Alfredo Pasta Meal Prep🥩🧀🔥 #recipe
    10 месяцев назад
  • Macro-Friendly, High Protein Sheet Pan Breakfast Burritos #shorts
    Macro-Friendly, High Protein Sheet Pan Breakfast Burritos #shorts
    9 месяцев назад
  • The Best Meal Prep I’ve Done To Date
    The Best Meal Prep I’ve Done To Date
    1 год назад
  • О нас
  • Контакты
  • Отказ от ответственности - Disclaimer
  • Условия использования сайта - TOS
  • Политика конфиденциальности

video2dn Copyright © 2023 - 2025

Контакты для правообладателей [email protected]